TCN1 polyclonal antibody (A01)
  • TCN1 polyclonal antibody (A01)

TCN1 polyclonal antibody (A01)

Ref: AB-H00006947-A01
TCN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TCN1.
Información adicional
Size 50 uL
Gene Name TCN1
Gene Alias TC1|TCI
Gene Description transcobalamin I (vitamin B12 binding protein, R binder family)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCN1 (AAH18632, 1 a.a. ~ 423 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6947

Enviar un mensaje


TCN1 polyclonal antibody (A01)

TCN1 polyclonal antibody (A01)