TCF12 monoclonal antibody (M01), clone 2E9
  • TCF12 monoclonal antibody (M01), clone 2E9

TCF12 monoclonal antibody (M01), clone 2E9

Ref: AB-H00006938-M01
TCF12 monoclonal antibody (M01), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCF12.
Información adicional
Size 100 ug
Gene Name TCF12
Gene Alias HEB|HTF4|HsT17266|bHLHb20
Gene Description transcription factor 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,ELISA,RNAi-Ab
Immunogen Prot. Seq VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCF12 (NP_996919, 364 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6938
Clone Number 2E9
Iso type IgG2a Kappa

Enviar un mensaje


TCF12 monoclonal antibody (M01), clone 2E9

TCF12 monoclonal antibody (M01), clone 2E9