TCF7L2 monoclonal antibody (M03), clone 3D7
  • TCF7L2 monoclonal antibody (M03), clone 3D7

TCF7L2 monoclonal antibody (M03), clone 3D7

Ref: AB-H00006934-M03
TCF7L2 monoclonal antibody (M03), clone 3D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCF7L2.
Información adicional
Size 100 ug
Gene Name TCF7L2
Gene Alias TCF-4|TCF4
Gene Description transcription factor 7-like 2 (T-cell specific, HMG-box)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCF7L2 (NP_110383, 490 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6934
Clone Number 3D7
Iso type IgG1 Kappa

Enviar un mensaje


TCF7L2 monoclonal antibody (M03), clone 3D7

TCF7L2 monoclonal antibody (M03), clone 3D7