Ver mas grande
TCF7L2 monoclonal antibody (M03), clone 3D7
AB-H00006934-M03
Producto nuevo
TCF7L2 monoclonal antibody (M03), clone 3D7
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | TCF7L2 |
| Gene Alias | TCF-4|TCF4 |
| Gene Description | transcription factor 7-like 2 (T-cell specific, HMG-box) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | TCF7L2 (NP_110383, 490 a.a. ~ 596 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6934 |
| Clone Number | 3D7 |
| Iso type | IgG1 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant TCF7L2.