TCF7L2 polyclonal antibody (A01)
  • TCF7L2 polyclonal antibody (A01)

TCF7L2 polyclonal antibody (A01)

Ref: AB-H00006934-A01
TCF7L2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TCF7L2.
Información adicional
Size 50 uL
Gene Name TCF7L2
Gene Alias TCF-4|TCF4
Gene Description transcription factor 7-like 2 (T-cell specific, HMG-box)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCF7L2 (NP_110383, 490 a.a. ~ 596 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6934

Enviar un mensaje


TCF7L2 polyclonal antibody (A01)

TCF7L2 polyclonal antibody (A01)