TCF3 monoclonal antibody (M01A), clone 5G2
  • TCF3 monoclonal antibody (M01A), clone 5G2

TCF3 monoclonal antibody (M01A), clone 5G2

Ref: AB-H00006929-M01A
TCF3 monoclonal antibody (M01A), clone 5G2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCF3.
Información adicional
Size 200 uL
Gene Name TCF3
Gene Alias E2A|ITF1|MGC129647|MGC129648|bHLHb21
Gene Description transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCF3 (NP_003191, 545 a.a. ~ 654 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6929
Clone Number 5G2
Iso type IgG2b Kappa

Enviar un mensaje


TCF3 monoclonal antibody (M01A), clone 5G2

TCF3 monoclonal antibody (M01A), clone 5G2