TCEB3 monoclonal antibody (M01), clone 3E2
  • TCEB3 monoclonal antibody (M01), clone 3E2

TCEB3 monoclonal antibody (M01), clone 3E2

Ref: AB-H00006924-M01
TCEB3 monoclonal antibody (M01), clone 3E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCEB3.
Información adicional
Size 100 ug
Gene Name TCEB3
Gene Alias FLJ38760|FLJ42849|SIII|TCEB3A
Gene Description transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCEB3 (NP_003189, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6924
Clone Number 3E2
Iso type IgG2a Kappa

Enviar un mensaje


TCEB3 monoclonal antibody (M01), clone 3E2

TCEB3 monoclonal antibody (M01), clone 3E2