TCEB2 monoclonal antibody (M03), clone 2B4
  • TCEB2 monoclonal antibody (M03), clone 2B4

TCEB2 monoclonal antibody (M03), clone 2B4

Ref: AB-H00006923-M03
TCEB2 monoclonal antibody (M03), clone 2B4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TCEB2.
Información adicional
Size 100 ug
Gene Name TCEB2
Gene Alias ELOB|SIII
Gene Description transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCEB2 (AAH13306, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6923
Clone Number 2B4
Iso type IgG2a Kappa

Enviar un mensaje


TCEB2 monoclonal antibody (M03), clone 2B4

TCEB2 monoclonal antibody (M03), clone 2B4