TCEB1 polyclonal antibody (A01)
  • TCEB1 polyclonal antibody (A01)

TCEB1 polyclonal antibody (A01)

Ref: AB-H00006921-A01
TCEB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant TCEB1.
Información adicional
Size 50 uL
Gene Name TCEB1
Gene Alias SIII
Gene Description transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCEB1 (AAH13809, 1 a.a. ~ 112 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6921

Enviar un mensaje


TCEB1 polyclonal antibody (A01)

TCEB1 polyclonal antibody (A01)