TCEA2 monoclonal antibody (M01), clone 7E11
  • TCEA2 monoclonal antibody (M01), clone 7E11

TCEA2 monoclonal antibody (M01), clone 7E11

Ref: AB-H00006919-M01
TCEA2 monoclonal antibody (M01), clone 7E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TCEA2.
Información adicional
Size 100 ug
Gene Name TCEA2
Gene Alias TFIIS
Gene Description transcription elongation factor A (SII), 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITTFPPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TCEA2 (NP_003186.1, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6919
Clone Number 7E11
Iso type IgG1 Kappa

Enviar un mensaje


TCEA2 monoclonal antibody (M01), clone 7E11

TCEA2 monoclonal antibody (M01), clone 7E11