TBL1X monoclonal antibody (M07), clone 2B6
  • TBL1X monoclonal antibody (M07), clone 2B6

TBL1X monoclonal antibody (M07), clone 2B6

Ref: AB-H00006907-M07
TBL1X monoclonal antibody (M07), clone 2B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TBL1X.
Información adicional
Size 100 ug
Gene Name TBL1X
Gene Alias EBI|SMAP55|TBL1
Gene Description transducin (beta)-like 1X-linked
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TBL1X (NP_005638, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6907
Clone Number 2B6
Iso type IgG2b Kappa

Enviar un mensaje


TBL1X monoclonal antibody (M07), clone 2B6

TBL1X monoclonal antibody (M07), clone 2B6