TBCD purified MaxPab mouse polyclonal antibody (B01P)
  • TBCD purified MaxPab mouse polyclonal antibody (B01P)

TBCD purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006904-B01P
TBCD purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TBCD protein.
Información adicional
Size 50 ug
Gene Name TBCD
Gene Alias KIAA0988
Gene Description tubulin folding cofactor D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MKISHWDGVIRELAARALHNLAQQAPEFSATQVFPRLLSMTLSPDLHTRHGSILACAEVAYALYKLAAQENRPVTDHLDEQAVQGLKQIHQQLYDRQLYRGLGGQLMRQAVCVLIEKLSLSKMPFRGDTVIDGWQWLINDTLRHLHLISSHSRQQMKDAAVSALAALCSEYYMKEPGEADPAIQEELITQYLAELRNPEEMTRCGFSLALGALPGFLLKGRLQQVLTGLRAVTHTSPEDVSFAESRRDGLKAIAR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TBCD (AAH39654.1, 1 a.a. ~ 623 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6904

Enviar un mensaje


TBCD purified MaxPab mouse polyclonal antibody (B01P)

TBCD purified MaxPab mouse polyclonal antibody (B01P)