TBCA monoclonal antibody (M03), clone 1D2
  • TBCA monoclonal antibody (M03), clone 1D2

TBCA monoclonal antibody (M03), clone 1D2

Ref: AB-H00006902-M03
TBCA monoclonal antibody (M03), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TBCA.
Información adicional
Size 100 ug
Gene Name TBCA
Gene Alias -
Gene Description tubulin folding cofactor A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMSAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TBCA (AAH18210, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6902
Clone Number 1D2
Iso type IgG2a Kappa

Enviar un mensaje


TBCA monoclonal antibody (M03), clone 1D2

TBCA monoclonal antibody (M03), clone 1D2