TARS monoclonal antibody (M01), clone 1A9
  • TARS monoclonal antibody (M01), clone 1A9

TARS monoclonal antibody (M01), clone 1A9

Ref: AB-H00006897-M01
TARS monoclonal antibody (M01), clone 1A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TARS.
Información adicional
Size 100 ug
Gene Name TARS
Gene Alias MGC9344|ThrRS
Gene Description threonyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,ELISA
Immunogen Prot. Seq RAELNPWPEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TARS (NP_689508, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6897
Clone Number 1A9
Iso type IgG2a Kappa

Enviar un mensaje


TARS monoclonal antibody (M01), clone 1A9

TARS monoclonal antibody (M01), clone 1A9