MAP3K7 monoclonal antibody (M04), clone 3C9
  • MAP3K7 monoclonal antibody (M04), clone 3C9

MAP3K7 monoclonal antibody (M04), clone 3C9

Ref: AB-H00006885-M04
MAP3K7 monoclonal antibody (M04), clone 3C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K7.
Información adicional
Size 100 ug
Gene Name MAP3K7
Gene Alias TAK1|TGF1a
Gene Description mitogen-activated protein kinase kinase kinase 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K7 (AAH17715.1, 471 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6885
Clone Number 3C9
Iso type IgG2a Kappa

Enviar un mensaje


MAP3K7 monoclonal antibody (M04), clone 3C9

MAP3K7 monoclonal antibody (M04), clone 3C9