TAF12 MaxPab mouse polyclonal antibody (B01)
  • TAF12 MaxPab mouse polyclonal antibody (B01)

TAF12 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00006883-B01
TAF12 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human TAF12 protein.
Información adicional
Size 50 uL
Gene Name TAF12
Gene Alias TAF2J|TAFII20
Gene Description TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF12 (AAH11986, 1 a.a. ~ 161 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6883

Enviar un mensaje


TAF12 MaxPab mouse polyclonal antibody (B01)

TAF12 MaxPab mouse polyclonal antibody (B01)