TAF7 purified MaxPab rabbit polyclonal antibody (D01P)
  • TAF7 purified MaxPab rabbit polyclonal antibody (D01P)

TAF7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006879-D01P
TAF7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TAF7 protein.
Información adicional
Size 100 ug
Gene Name TAF7
Gene Alias TAF2F|TAFII55
Gene Description TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TAF7 (NP_005633.2, 1 a.a. ~ 349 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6879

Enviar un mensaje


TAF7 purified MaxPab rabbit polyclonal antibody (D01P)

TAF7 purified MaxPab rabbit polyclonal antibody (D01P)