TAF4 polyclonal antibody (A01)
  • TAF4 polyclonal antibody (A01)

TAF4 polyclonal antibody (A01)

Ref: AB-H00006874-A01
TAF4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TAF4.
Información adicional
Size 50 uL
Gene Name TAF4
Gene Alias FLJ41943|TAF2C|TAF2C1|TAF4A|TAFII130|TAFII135
Gene Description TAF4 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 135kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LQPPVLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLPGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TAF4 (NP_003176, 715 a.a. ~ 800 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6874

Enviar un mensaje


TAF4 polyclonal antibody (A01)

TAF4 polyclonal antibody (A01)