VAMP1 monoclonal antibody (M01), clone 5F3
  • VAMP1 monoclonal antibody (M01), clone 5F3

VAMP1 monoclonal antibody (M01), clone 5F3

Ref: AB-H00006843-M01
VAMP1 monoclonal antibody (M01), clone 5F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant VAMP1.
Información adicional
Size 100 ug
Gene Name VAMP1
Gene Alias DKFZp686H12131|SYB1|VAMP-1
Gene Description vesicle-associated membrane protein 1 (synaptobrevin 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VAMP1 (NP_055046, 28 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6843
Clone Number 5F3
Iso type IgG2a Lambda

Enviar un mensaje


VAMP1 monoclonal antibody (M01), clone 5F3

VAMP1 monoclonal antibody (M01), clone 5F3