SVIL monoclonal antibody (M03), clone 6E10
  • SVIL monoclonal antibody (M03), clone 6E10

SVIL monoclonal antibody (M03), clone 6E10

Ref: AB-H00006840-M03
SVIL monoclonal antibody (M03), clone 6E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SVIL.
Información adicional
Size 100 ug
Gene Name SVIL
Gene Alias DKFZp686A17191
Gene Description supervillin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SVIL (NP_003165, 1679 a.a. ~ 1786 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6840
Clone Number 6E10
Iso type IgG2a Kappa

Enviar un mensaje


SVIL monoclonal antibody (M03), clone 6E10

SVIL monoclonal antibody (M03), clone 6E10