SVIL polyclonal antibody (A01)
  • SVIL polyclonal antibody (A01)

SVIL polyclonal antibody (A01)

Ref: AB-H00006840-A01
SVIL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SVIL.
Información adicional
Size 50 uL
Gene Name SVIL
Gene Alias DKFZp686A17191
Gene Description supervillin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LIHAGLEPLTFTNMFPSWEHREDIAEITEMDTEVSNQITLVEDVLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SVIL (NP_003165, 1679 a.a. ~ 1786 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6840

Enviar un mensaje


SVIL polyclonal antibody (A01)

SVIL polyclonal antibody (A01)