SURF5 monoclonal antibody (M01), clone 3A9
  • SURF5 monoclonal antibody (M01), clone 3A9

SURF5 monoclonal antibody (M01), clone 3A9

Ref: AB-H00006837-M01
SURF5 monoclonal antibody (M01), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SURF5.
Información adicional
Size 100 ug
Gene Name MED22
Gene Alias MED24|MGC48682|SURF5
Gene Description mediator complex subunit 22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SURF5 (NP_006743.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6837
Clone Number 3A9
Iso type IgG2a Kappa

Enviar un mensaje


SURF5 monoclonal antibody (M01), clone 3A9

SURF5 monoclonal antibody (M01), clone 3A9