SUPT4H1 polyclonal antibody (A01)
  • SUPT4H1 polyclonal antibody (A01)

SUPT4H1 polyclonal antibody (A01)

Ref: AB-H00006827-A01
SUPT4H1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SUPT4H1.
Información adicional
Size 50 uL
Gene Name SUPT4H1
Gene Alias SPT4|SPT4H|SUPT4H
Gene Description suppressor of Ty 4 homolog 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUPT4H1 (NP_003159, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6827

Enviar un mensaje


SUPT4H1 polyclonal antibody (A01)

SUPT4H1 polyclonal antibody (A01)