SULT2B1 monoclonal antibody (M03), clone 2E5
  • SULT2B1 monoclonal antibody (M03), clone 2E5

SULT2B1 monoclonal antibody (M03), clone 2E5

Ref: AB-H00006820-M03
SULT2B1 monoclonal antibody (M03), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SULT2B1.
Información adicional
Size 100 ug
Gene Name SULT2B1
Gene Alias HSST2
Gene Description sulfotransferase family, cytosolic, 2B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULT2B1 (NP_814444, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6820
Clone Number 2E5
Iso type IgG1 Kappa

Enviar un mensaje


SULT2B1 monoclonal antibody (M03), clone 2E5

SULT2B1 monoclonal antibody (M03), clone 2E5