SULT2B1 polyclonal antibody (A01)
  • SULT2B1 polyclonal antibody (A01)

SULT2B1 polyclonal antibody (A01)

Ref: AB-H00006820-A01
SULT2B1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SULT2B1.
Información adicional
Size 50 uL
Gene Name SULT2B1
Gene Alias HSST2
Gene Description sulfotransferase family, cytosolic, 2B, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULT2B1 (NP_814444, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6820

Enviar un mensaje


SULT2B1 polyclonal antibody (A01)

SULT2B1 polyclonal antibody (A01)