NEK4 monoclonal antibody (M02), clone 2E9
  • NEK4 monoclonal antibody (M02), clone 2E9

NEK4 monoclonal antibody (M02), clone 2E9

Ref: AB-H00006787-M02
NEK4 monoclonal antibody (M02), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEK4.
Información adicional
Size 50 ug
Gene Name NEK4
Gene Alias MGC33171|NRK2|STK2|pp12301
Gene Description NIMA (never in mitosis gene a)-related kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK4 (AAH63044, 680 a.a. ~ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6787
Clone Number 2E9
Iso type IgG2a Kappa

Enviar un mensaje


NEK4 monoclonal antibody (M02), clone 2E9

NEK4 monoclonal antibody (M02), clone 2E9