NEK4 polyclonal antibody (A01)
  • NEK4 polyclonal antibody (A01)

NEK4 polyclonal antibody (A01)

Ref: AB-H00006787-A01
NEK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NEK4.
Información adicional
Size 50 uL
Gene Name NEK4
Gene Alias MGC33171|NRK2|STK2|pp12301
Gene Description NIMA (never in mitosis gene a)-related kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK4 (AAH63044, 680 a.a. ~ 781 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6787

Enviar un mensaje


NEK4 polyclonal antibody (A01)

NEK4 polyclonal antibody (A01)