SULT1E1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SULT1E1 purified MaxPab rabbit polyclonal antibody (D01P)

SULT1E1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006783-D01P
SULT1E1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SULT1E1 protein.
Información adicional
Size 100 ug
Gene Name SULT1E1
Gene Alias EST|EST-1|MGC34459|STE
Gene Description sulfotransferase family 1E, estrogen-preferring, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSLPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SULT1E1 (AAH27956.1, 1 a.a. ~ 294 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6783

Enviar un mensaje


SULT1E1 purified MaxPab rabbit polyclonal antibody (D01P)

SULT1E1 purified MaxPab rabbit polyclonal antibody (D01P)