STCH monoclonal antibody (M02), clone 1H8
  • STCH monoclonal antibody (M02), clone 1H8

STCH monoclonal antibody (M02), clone 1H8

Ref: AB-H00006782-M02
STCH monoclonal antibody (M02), clone 1H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STCH.
Información adicional
Size 100 ug
Gene Name HSPA13
Gene Alias STCH
Gene Description heat shock protein 70kDa family, member 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq EDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGSWPLQVSALEIPNKHLQKTNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STCH (NP_008879.3, 375 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6782
Clone Number 1H8
Iso type IgG2a Kappa

Enviar un mensaje


STCH monoclonal antibody (M02), clone 1H8

STCH monoclonal antibody (M02), clone 1H8