STC1 monoclonal antibody (M01), clone 4H4
  • STC1 monoclonal antibody (M01), clone 4H4

STC1 monoclonal antibody (M01), clone 4H4

Ref: AB-H00006781-M01
STC1 monoclonal antibody (M01), clone 4H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STC1.
Información adicional
Size 100 ug
Gene Name STC1
Gene Alias STC
Gene Description stanniocalcin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STC1 (AAH29044, 141 a.a. ~ 247 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6781
Clone Number 4H4
Iso type IgG2a Kappa

Enviar un mensaje


STC1 monoclonal antibody (M01), clone 4H4

STC1 monoclonal antibody (M01), clone 4H4