STAT5A monoclonal antibody (M02), clone 1B12
  • STAT5A monoclonal antibody (M02), clone 1B12

STAT5A monoclonal antibody (M02), clone 1B12

Ref: AB-H00006776-M02
STAT5A monoclonal antibody (M02), clone 1B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT5A.
Información adicional
Size 100 ug
Gene Name STAT5A
Gene Alias MGF|STAT5
Gene Description signal transducer and activator of transcription 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT5A (AAH27036, 1 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6776
Clone Number 1B12
Iso type IgG1 Kappa

Enviar un mensaje


STAT5A monoclonal antibody (M02), clone 1B12

STAT5A monoclonal antibody (M02), clone 1B12