STAT5A monoclonal antibody (M01A), clone 1E3
  • STAT5A monoclonal antibody (M01A), clone 1E3

STAT5A monoclonal antibody (M01A), clone 1E3

Ref: AB-H00006776-M01A
STAT5A monoclonal antibody (M01A), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT5A.
Información adicional
Size 200 uL
Gene Name STAT5A
Gene Alias MGF|STAT5
Gene Description signal transducer and activator of transcription 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT5A (AAH27036, 1 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6776
Clone Number 1E3
Iso type IgG1 Kappa

Enviar un mensaje


STAT5A monoclonal antibody (M01A), clone 1E3

STAT5A monoclonal antibody (M01A), clone 1E3