STAT5A purified MaxPab rabbit polyclonal antibody (D01P)
  • STAT5A purified MaxPab rabbit polyclonal antibody (D01P)

STAT5A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006776-D01P
STAT5A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STAT5A protein.
Información adicional
Size 100 ug
Gene Name STAT5A
Gene Alias MGF|STAT5
Gene Description signal transducer and activator of transcription 5A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STAT5A (NP_003143.2, 1 a.a. ~ 794 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6776

Enviar un mensaje


STAT5A purified MaxPab rabbit polyclonal antibody (D01P)

STAT5A purified MaxPab rabbit polyclonal antibody (D01P)