STAT1 monoclonal antibody (M01), clone 1A8
  • STAT1 monoclonal antibody (M01), clone 1A8

STAT1 monoclonal antibody (M01), clone 1A8

Ref: AB-H00006772-M01
STAT1 monoclonal antibody (M01), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant STAT1.
Información adicional
Size 100 ug
Gene Name STAT1
Gene Alias DKFZp686B04100|ISGF-3|STAT91
Gene Description signal transducer and activator of transcription 1, 91kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq TFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAT1 (AAH02704, 613 a.a. ~ 712 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6772
Clone Number 1A8
Iso type IgG2a Kappa

Enviar un mensaje


STAT1 monoclonal antibody (M01), clone 1A8

STAT1 monoclonal antibody (M01), clone 1A8