STAC polyclonal antibody (A01)
  • STAC polyclonal antibody (A01)

STAC polyclonal antibody (A01)

Ref: AB-H00006769-A01
STAC polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STAC.
Información adicional
Size 50 uL
Gene Name STAC
Gene Alias FLJ32331|STAC1
Gene Description SH3 and cysteine rich domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STAC (AAH20221, 209 a.a. ~ 318 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6769

Enviar un mensaje


STAC polyclonal antibody (A01)

STAC polyclonal antibody (A01)