ST13 monoclonal antibody (M02), clone 2B2
  • ST13 monoclonal antibody (M02), clone 2B2

ST13 monoclonal antibody (M02), clone 2B2

Ref: AB-H00006767-M02
ST13 monoclonal antibody (M02), clone 2B2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ST13.
Información adicional
Size 100 ug
Gene Name ST13
Gene Alias AAG2|FAM10A1|FAM10A4|FLJ27260|HIP|HOP|HSPABP|HSPABP1|MGC129952|P48|PRO0786|SNC6
Gene Description suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST13 (AAH15317, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6767
Clone Number 2B2
Iso type IgG2a Kappa

Enviar un mensaje


ST13 monoclonal antibody (M02), clone 2B2

ST13 monoclonal antibody (M02), clone 2B2