ST5 monoclonal antibody (M01), clone 1A3
  • ST5 monoclonal antibody (M01), clone 1A3

ST5 monoclonal antibody (M01), clone 1A3

Ref: AB-H00006764-M01
ST5 monoclonal antibody (M01), clone 1A3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ST5.
Información adicional
Size 100 ug
Gene Name ST5
Gene Alias DENND2B|HTS1|MGC33090|p126
Gene Description suppression of tumorigenicity 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VGHYSLFLTQSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKGLFEQRVEQYLEELPDTEQSGMNKFLRGLGNKMKFLHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST5 (NP_005409, 1038 a.a. ~ 1135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6764
Clone Number 1A3
Iso type IgG1 Kappa

Enviar un mensaje


ST5 monoclonal antibody (M01), clone 1A3

ST5 monoclonal antibody (M01), clone 1A3