SSX4 polyclonal antibody (A01)
  • SSX4 polyclonal antibody (A01)

SSX4 polyclonal antibody (A01)

Ref: AB-H00006759-A01
SSX4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SSX4.
Información adicional
Size 50 uL
Gene Name SSX4
Gene Alias MGC119056|MGC12411
Gene Description synovial sarcoma, X breakpoint 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq RNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SSX4 (NP_005627, 91 a.a. ~ 188 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6759

Enviar un mensaje


SSX4 polyclonal antibody (A01)

SSX4 polyclonal antibody (A01)