SSTR5 purified MaxPab rabbit polyclonal antibody (D01P)
  • SSTR5 purified MaxPab rabbit polyclonal antibody (D01P)

SSTR5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006755-D01P
SSTR5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SSTR5 protein.
Información adicional
Size 100 ug
Gene Name SSTR5
Gene Alias -
Gene Description somatostatin receptor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SSTR5 (AAI46577.1, 1 a.a. ~ 364 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6755

Enviar un mensaje


SSTR5 purified MaxPab rabbit polyclonal antibody (D01P)

SSTR5 purified MaxPab rabbit polyclonal antibody (D01P)