SST polyclonal antibody (A01)
  • SST polyclonal antibody (A01)

SST polyclonal antibody (A01)

Ref: AB-H00006750-A01
SST polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SST.
Información adicional
Size 50 uL
Gene Name SST
Gene Alias SMST
Gene Description somatostatin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SST (NP_001039, 26 a.a. ~ 116 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6750

Enviar un mensaje


SST polyclonal antibody (A01)

SST polyclonal antibody (A01)