SSB polyclonal antibody (A01)
  • SSB polyclonal antibody (A01)

SSB polyclonal antibody (A01)

Ref: AB-H00006741-A01
SSB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SSB.
Información adicional
Size 50 uL
Gene Name SSB
Gene Alias LARP3|La
Gene Description Sjogren syndrome antigen B (autoantigen La)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEEDAEMKSLEEKIGCLLKFSGDLDDQTCREDLHILFSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SSB (AAH01289, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6741

Enviar un mensaje


SSB polyclonal antibody (A01)

SSB polyclonal antibody (A01)