TROVE2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TROVE2 purified MaxPab rabbit polyclonal antibody (D01P)

TROVE2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006738-D01P
TROVE2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TROVE2 protein.
Información adicional
Size 100 ug
Gene Name TROVE2
Gene Alias RO60|SSA2
Gene Description TROVE domain family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TROVE2 (NP_004591.2, 1 a.a. ~ 538 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6738

Enviar un mensaje


TROVE2 purified MaxPab rabbit polyclonal antibody (D01P)

TROVE2 purified MaxPab rabbit polyclonal antibody (D01P)