TROVE2 polyclonal antibody (A01)
  • TROVE2 polyclonal antibody (A01)

TROVE2 polyclonal antibody (A01)

Ref: AB-H00006738-A01
TROVE2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TROVE2.
Información adicional
Size 50 uL
Gene Name TROVE2
Gene Alias RO60|SSA2
Gene Description TROVE domain family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TROVE2 (NP_004591, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6738

Enviar un mensaje


TROVE2 polyclonal antibody (A01)

TROVE2 polyclonal antibody (A01)