SRP19 purified MaxPab rabbit polyclonal antibody (D01P)
  • SRP19 purified MaxPab rabbit polyclonal antibody (D01P)

SRP19 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006728-D01P
SRP19 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SRP19 protein.
Información adicional
Size 100 ug
Gene Name SRP19
Gene Alias -
Gene Description signal recognition particle 19kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRP19 (NP_003126.1, 1 a.a. ~ 144 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6728

Enviar un mensaje


SRP19 purified MaxPab rabbit polyclonal antibody (D01P)

SRP19 purified MaxPab rabbit polyclonal antibody (D01P)