SRF monoclonal antibody (M05), clone 4D2
  • SRF monoclonal antibody (M05), clone 4D2

SRF monoclonal antibody (M05), clone 4D2

Ref: AB-H00006722-M05
SRF monoclonal antibody (M05), clone 4D2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SRF.
Información adicional
Size 100 ug
Gene Name SRF
Gene Alias MCM1
Gene Description serum response factor (c-fos serum response element-binding transcription factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SRF (NP_003122, 244 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6722
Clone Number 4D2
Iso type IgG2a Kappa

Enviar un mensaje


SRF monoclonal antibody (M05), clone 4D2

SRF monoclonal antibody (M05), clone 4D2