SREBF2 polyclonal antibody (A01)
  • SREBF2 polyclonal antibody (A01)

SREBF2 polyclonal antibody (A01)

Ref: AB-H00006721-A01
SREBF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SREBF2.
Información adicional
Size 50 uL
Gene Name SREBF2
Gene Alias SREBP2|bHLHd2
Gene Description sterol regulatory element binding transcription factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SREBF2 (AAH56158, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6721

Enviar un mensaje


SREBF2 polyclonal antibody (A01)

SREBF2 polyclonal antibody (A01)