SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)

SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006715-D01P
SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SRD5A1 protein.
Información adicional
Size 100 ug
Gene Name SRD5A1
Gene Alias -
Gene Description steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIII
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRD5A1 (NP_001038.1, 1 a.a. ~ 259 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6715

Enviar un mensaje


SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)

SRD5A1 purified MaxPab rabbit polyclonal antibody (D01P)