SRC monoclonal antibody (M01), clone 1B9
  • SRC monoclonal antibody (M01), clone 1B9

SRC monoclonal antibody (M01), clone 1B9

Ref: AB-H00006714-M01
SRC monoclonal antibody (M01), clone 1B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SRC.
Información adicional
Size 100 ug
Gene Name SRC
Gene Alias ASV|SRC1|c-SRC|p60-Src
Gene Description v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,PLA-Ce,IF
Immunogen Prot. Seq MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SRC (AAH11566, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6714
Clone Number 1B9
Iso type IgG2a Kappa

Enviar un mensaje


SRC monoclonal antibody (M01), clone 1B9

SRC monoclonal antibody (M01), clone 1B9