SRC purified MaxPab mouse polyclonal antibody (B01P)
  • SRC purified MaxPab mouse polyclonal antibody (B01P)

SRC purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006714-B01P
SRC purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SRC protein.
Información adicional
Size 50 ug
Gene Name SRC
Gene Alias ASV|SRC1|c-SRC|p60-Src
Gene Description v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SRC (NP_005408.1, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6714

Enviar un mensaje


SRC purified MaxPab mouse polyclonal antibody (B01P)

SRC purified MaxPab mouse polyclonal antibody (B01P)