SPTBN2 monoclonal antibody (M06), clone 4D9
  • SPTBN2 monoclonal antibody (M06), clone 4D9

SPTBN2 monoclonal antibody (M06), clone 4D9

Ref: AB-H00006712-M06
SPTBN2 monoclonal antibody (M06), clone 4D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPTBN2.
Información adicional
Size 100 ug
Gene Name SPTBN2
Gene Alias GTRAP41|SCA5
Gene Description spectrin, beta, non-erythrocytic 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPTBN2 (NP_008877, 643 a.a. ~ 720 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6712
Clone Number 4D9
Iso type IgG3 Kappa

Enviar un mensaje


SPTBN2 monoclonal antibody (M06), clone 4D9

SPTBN2 monoclonal antibody (M06), clone 4D9