SPRR2F monoclonal antibody (M03), clone 5A9
  • SPRR2F monoclonal antibody (M03), clone 5A9

SPRR2F monoclonal antibody (M03), clone 5A9

Ref: AB-H00006705-M03
SPRR2F monoclonal antibody (M03), clone 5A9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SPRR2F.
Información adicional
Size 100 ug
Gene Name SPRR2F
Gene Alias -
Gene Description small proline-rich protein 2F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPRR2F (NP_001014450.1, 1 a.a. ~ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6705
Clone Number 5A9
Iso type IgG1 Kappa

Enviar un mensaje


SPRR2F monoclonal antibody (M03), clone 5A9

SPRR2F monoclonal antibody (M03), clone 5A9